← Back to catalogue
Generated draft

art

vr.tr.art-act · ACT.ACT

the creation of beautiful or significant things

Thing Registry Activities and processes

Generated draft, first pass

This model was drafted by rule from what the registry knows about the thing. It proposes which bundles a real model will need and which questions research must answer. It is not researched and no sentence in it is sourced.

Written from the archetype playbook - what this kind of thing needs beyond identity and provenance - and from the structure that recurred across 6,333 models already researched by two engines. Applied to this entry by rule. No source was read for this thing and no claim here is researched.

Generator: vr.draft.v3

Purpose and description

Give an agent a durable, checkable way to recognise a art, record what state it is in, and decide what may be done with it.

the creation of beautiful or significant things

It can be observed and measured.

Distinguishing features

Names folded into this entry, which a task may need to split apart again: artistic creation, artistic production, arts and crafts, ceramics, decalcomania, decoupage, drawing, draftsmanship, drafting, glyptography, gastronomy, origami.

31 finer distinctions are held as aliases rather than separate entries, because telling them apart needs a task that asks for it.

Physical character

Made of: something that happens over time.

Does nothing on its own; everything it does, something else did to it.

How it is recognised

Nothing to see. What is recognised is an instance of it, and which instances count is exactly what is argued about.

Related models

covers - Finer kinds folded into this entry because telling them apart needs a task that asks for it. Each is a model waiting to be split out when one does.

artistic creationartistic productionarts and craftsceramicsdecalcomaniadecoupagedrawingdraftsmanshipdraftingglyptographygastronomyorigami

31 finer distinctions are held inside this entry as names rather than as separate models.

Analytical facets

substance
activity
origin
conceptual
agency
inert
mobility
not-applicable
scale
not-applicable
affordances
observable

Also called

artistic creationartistic productionarts and craftsceramicsdecalcomaniadecoupagedrawingdraftsmanshipdraftingglyptographygastronomyorigamipaintingdistemperfrescoimpastoperfumeryprintmakingsculpturecarvingmodelingmodellingmoldingmouldingtopiarypyrographytracingoil paintingwatercolorwater-colorwatercolourwater-colourengravingetchingsteel engravingaquatintserigraphylithographyspeedpaintwood carving

+3

Where this came from

oewn:2024 · CC BY 4.0

Drafted structure

Bundle to layer to finding to question, as the second pass will find it: 6 bundles · 12 layers · 14 findings · 38 questions.

Identity, naming and classification How an agent tells one art from another, and a art from things that resemble it.

Recognition comes before every other claim. Without stable identity nothing else in the model can be trusted to be about the same thing twice.

Names and identifiers

The names this thing goes by and the identifiers that survive translation and time.

Preferred name, aliases and local names

Which name to use, which names mean the same thing, and which merely sound similar.

  1. What identifies and describes the name of a art, and in what units or vocabulary? definition
  2. Who or what asserted this about the name of a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once the name of a art is known, and what must it refuse? action

Stable identifiers and external keys

Identifiers that keep pointing at this kind of thing across systems and languages.

  1. What identifies and describes an identifier for a art, and in what units or vocabulary? definition
  2. Who or what asserted this about an identifier for a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once an identifier for a art is known, and what must it refuse? action

Classification and granularity

Where a art sits among kinds, and how finely a task needs to cut it.

Kind, parents and neighbouring kinds

The classes this thing belongs to and the ones it is next to.

  1. What identifies and describes the kind of a art, and in what units or vocabulary? definition
  2. Who or what asserted this about the kind of a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once the kind of a art is known, and what must it refuse? action

Distinguishing features

What separates a art from the things most often confused with it.

  1. What identifies and describes what distinguishes a art, and in what units or vocabulary? definition
  2. Who or what asserted this about what distinguishes a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once what distinguishes a art is known, and what must it refuse? action
State and lifecycle The states a art passes through and the events that move it between them.

Most decisions about a thing depend on what state it is in now, which is a claim with a time on it, not a property.

Lifecycle stages

From coming into existence to ceasing to be one of these.

Stages and transitions

The stages worth naming and what moves a art between them.

  1. What identifies and describes the lifecycle of a art, and in what units or vocabulary? definition
  2. Who or what asserted this about the lifecycle of a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once the lifecycle of a art is known, and what must it refuse? action

Observations and current status

What is observed about a art, how often and by whom.

Observation record

How an observation of a art is recorded so that it can be superseded rather than overwritten.

  1. What identifies and describes an observation of a art, and in what units or vocabulary? definition
  2. Who or what asserted this about an observation of a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once an observation of a art is known, and what must it refuse? action
Process, inputs and outcome How a art proceeds, what it needs and what it leaves behind.

An activity is known by its steps and its results, and both have to be recordable while it is still running.

Steps and sequence

The steps of a art, their order and what may run in parallel.

Steps, preconditions and completion

What has to be true before each step of a art and what marks it done.

  1. What identifies and describes a step of a art, and in what units or vocabulary? definition
  2. Who or what asserted this about a step of a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once a step of a art is known, and what must it refuse? action

Inputs, resources and results

What a art consumes and what it produces.

Inputs, outputs and side effects

The resources a art takes and the results it leaves, wanted or not.

  1. What identifies and describes the inputs and results of a art, and in what units or vocabulary? definition
  2. Who or what asserted this about the inputs and results of a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once the inputs and results of a art is known, and what must it refuse? action
Definitions and who holds them What art is taken to mean, and by whom.

When a field disagrees about a concept, the disagreement is the content. A model that picks one definition silently destroys the information.

Competing definitions

The main readings and the traditions behind them.

Definitions and their holders

Each definition with the school or body that holds it.

  1. Which definitions of art are in use, and which tradition or body holds each? definition
  2. What turns on the difference between them in practice? boundary

Operationalisation

How it is measured or applied when it has to be.

Measures and proxies

Instruments and indicators used to stand in for it.

  1. How is art operationalised or measured in practice, and by what instrument? measurement
  2. What does that operationalisation leave out, and when does that matter? boundary
Instances, use and consequence What counts as an instance of art and what follows from calling something that.

Applying a concept is an act with consequences, so a model must say what the label licenses and what it does not.

What counts as an instance

Clear cases, borderline cases and non-cases.

Tests for an instance

What would settle whether something falls under it.

  1. What would settle whether something is an instance of art? boundary
  2. Which borderline cases are argued about, and on what grounds? definition

Consequence of application

Rights, duties or decisions that follow from the label.

What the label licenses

What an agent may do once something is classified this way.

  1. What follows practically once something is treated as art? action
  2. What must an agent not infer from the label alone? action
Provenance, evidence and time Where every claim about a art came from and when it held.

A claim without a source and a time cannot be superseded, only overwritten, and an agent that overwrites loses the ability to explain itself.

Source and authority

Who said it, on what evidence, and how strongly.

Claim provenance and confidence

The authority behind each claim about a art and how confident it is.

  1. What identifies and describes a claim about a art, and in what units or vocabulary? definition
  2. Who or what asserted this about a claim about a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once a claim about a art is known, and what must it refuse? action

Time, versions and supersession

When a claim was true, when it was learnt, and what replaced it.

Validity period and supersession

How an old claim about a art is retired without being erased.

  1. What identifies and describes the validity of a claim about a art, and in what units or vocabulary? definition
  2. Who or what asserted this about the validity of a claim about a art, by which method, and when was it true? provenance
  3. What may an agent decide or do once the validity of a claim about a art is known, and what must it refuse? action

What the second pass must settle

  • Which of the bundles below does a real task actually need, and which are ceremony?
  • What does this thing have that the facets do not capture at all?
  • Which neighbouring kind is most often confused with a art, and on what evidence are they told apart?